- Exostosin-like 1/EXTL1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90470
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- EXTL
- Human
- Exostosin-like 1/EXTL1
- This antibody was developed against Recombinant Protein corresponding to amino acids: ALPPRPRPGA SQGWPRWLDA ELLQSFSQPG ELPEDAVSPP QAPHGGSCNW ESCFDTSKCR GDGLKVFVYP AVGTISETHR RILASIEGS
- 0.1 ml (also 25ul)
- exostosin like glycosyltransferase 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS
Specifications/Features
Available conjugates: Unconjugated